Join Free For Buyer|Sign In

Professional Online Trade Platform for API, Preparation and Pharmaceutical Machinery and Equipment_EN-CPhI.cn

You are here: Home >>  CAS No. Inquiry

CAS No. List 1 2 3 4 5 6 7 8 9
CAS NO. CAS Name Alias Suppliers
1000343-46-3 4-BROMO-3-CHLORO [1H]INDAZOLE 4-BROMO-3-CHLORO [1H]INDAZOLE;1H-INDAZOLE,4-BROMO-3-CHLORO- 5supplier(s)
1000343-46-3
1000343-59-8 3-AMINO-7-METHYL (1H)INDAZOLE 3-AMINO-7-METHYL (1H)INDAZOLE 2supplier(s)
1000343-59-8
1000343-69-0 6-BROMO-5-METHYL (1H)INDAZOLE 6-BROMO-5-METHYL (1H)INDAZOLE 6supplier(s)
1000343-69-0
100035-75-4 EVODIAE EXTRACT 10% EVODIAMINE EVODIAE EXTRACT 10% EVODIAMINE;Evandamine 1supplier(s)
100035-75-4
100036-64-4 3'-TRIFLUOROMETHYLBIPHENYL-4-CARBALDEHYDE AKOS BAR-0093;3'-(TRIFLUOROMETHYL)[1,1'-BIPHENYL]-4-CARBALDEHYDE;3'-(TRIFLUOROMETHYL)[1,1'-BIPHENYL]-4-CARBOXALDEHYDE;3'-TRIFLUOROMETHYLBIPHENYL-4-CARBALDEHYDE;[1,1'-BIPHENYL]-4-CARBOXALDEHYDE, 3'-(TRIFLUOROMETHYL)-;4-(3-(Trifluoromethyl)phenyl)benzaldehyde;3'-(TrifluoroMethyl)biphenyl-4-carboxaldehyde, 96% 9supplier(s)
100036-64-4
100037-69-2 PIPES sesquisodium salt 1,4-piperazinediethanesulfonicacid,sodiumsalt(2:3); PIPERAZINE-1,4-BIS(2-ETHANESULFONIC ACID) SESQUISODIUM SALT; PIPERAZINE-N,N'-BIS-(2-ETHANESULPHONIC ACID) SESQUISODIUM SALT; PIPERAZINE-N,N'-BIS(2-ETHANESULFONIC ACID), 1.5NA; PIPERAZINE-N,N-BIS (2-ETHANESULFONIC ACID), 1.5 SODIUM; PIPERAZINE-N,N'-BIS(2-ETHANESULFONIC ACID) 1.5 SODIUM SALT; PIPERAZINE-N,N-BIS(2-ETHANESULFONIC ACID) SESQUISODIUM SALT; PIPERAZINE-N,N'-BIS[2-ETHANESULFONIC ACID] SESQUISODIUM SALT; PIPES-Na; 1,4-piperazinediethanesulfonic acid, sodium salt (2:3) 33supplier(s)
100037-69-2
100037-71-6 Thieno[2,3-c]pyridine, 2,3-dihydro-7-methyl- (9CI) Thieno[2,3-c]pyridine, 2,3-dihydro-7-methyl- (9CI) 1supplier(s)
100037-71-6
100038-00-4 Spiro[1H-indene-1,3-pyrrolidine]-4,5-diol, 2,3-dihydro- (9CI) Spiro[1H-indene-1,3-pyrrolidine]-4,5-diol, 2,3-dihydro- (9CI) 1supplier(s)
100038-00-4
100038-04-8 Spiro[1H-indene-1,3-pyrrolidine]-5,6-diol, 2,3-dihydro- (9CI) Spiro[1H-indene-1,3-pyrrolidine]-5,6-diol, 2,3-dihydro- (9CI) 1supplier(s)
100038-04-8
100039-07-4 2-Pyrrolidinone,5-amino-,(R)-(9CI) 2-Pyrrolidinone,5-amino-,(R)-(9CI) 1supplier(s)
100039-07-4
10004-44-1 3-hydroxy-5-methylisoxazole Hydroxyisoxazole; Hymexazol; Itachioaren; Tachigaren; 5-methylisoxazol-3-ol; 5-methyl-3(2H)-isoxazolone; 5-methyl-1,2-oxazol-3(2H)-one 62supplier(s)
10004-44-1
10004-45-2 3(2H)-Isoxazolone, 5-ethyl- 3(2H)-Isoxazolone, 5-ethyl- 1supplier(s)
10004-45-2
10004-47-4 3(2H)-Isoxazolone, 5-(1-Methylethyl)- 3(2H)-Isoxazolone, 5-(1-Methylethyl)- 1supplier(s)
10004-47-4
100040-31-1 GIP (HUMAN) H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN 13supplier(s)
100040-31-1
100041-05-2 flazin flazin;1-[5-(Hydroxymethyl)furan-2-yl]-9H-pyrido[3,4-b]indole-3-carboxylic acid;Flazine 1supplier(s)
100041-05-2
CAS No. List Hot CAS No. CAS Index Commonly Used Chemical CAS No. List New Products List
CAS NO.: 1 2 3 4 5 6 7 8 9
More CAS No. List:
[1-15][16-30][31-45][46-60][61-75][76-90][91-105][106-120][121-135][136-150][151-165][166-180][181-195][196-210][211-225][226-240][241-255][256-270][271-285][286-300][301-315][316-330][331-345][346-360][361-375][376-390][391-405][406-420][421-435][436-450][More]
Follow Us
CPhI Online Trade Platform: Worldwide|English|中国站
Customer Service:  86-400 610 1188 (9: 00-18: 00, Mon-Fri)
About Us| Contact Us| Terms of Services| Privacy Policy| Intellectual Property Statement| Links | Site Map
Copyright 2006-20 Shanghai UBM Sinoexpo International Exhibition Co Ltd (All Rights Reserved). ICP 05034851-53